Биологическая активность
BDNF (human) is a neurotrophin in the central nervous system?and mediates survival and differentiation of neurons. BDNF (human) binds to TrkB and leads to the dimerization and autophosphorylation of tyrosine residues in the intracellular domain of the рецептор. BDNF (human) can be used for study of neurodegenerative and psychiatric disorder.
Оригинал на английском
BDNF (human) is a neurotrophin in the central nervous system?and mediates survival and differentiation of neurons. BDNF (human) binds to TrkB and leads to the dimerization and autophosphorylation of tyrosine residues in the intracellular domain of the receptor. BDNF (human) can be used for study of neurodegenerative and psychiatric disorder.
Химические свойства
- CAS №
- 218441-99-7
- Брутто-формула
- C₅₈₁H₉₄₁N₁₇₇O₁₇₇S₉
- Мол. масса
- 13526.35 г/моль
- Синонимы
- HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYNRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Хранение и физические свойства
- Условия хранения
- Please store the product under the recommended conditions in the Certificate of Analysis.
Безопасность и документация
Только для научно-исследовательского применения. Не предназначено для использования у пациентов или в качестве лекарственного средства.